Lineage for d3pb5a_ (3pb5 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1549490Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1550211Protein automated matches [190156] (4 species)
    not a true protein
  7. 1550214Species Cryphonectria parasitica [TaxId:5116] [187236] (21 PDB entries)
  8. 1550233Domain d3pb5a_: 3pb5 A: [183628]
    automated match to d1e5oe_
    complexed with f63, gol

Details for d3pb5a_

PDB Entry: 3pb5 (more details), 1.9 Å

PDB Description: endothiapepsin in complex with a fragment
PDB Compounds: (A:) endothiapepsin

SCOPe Domain Sequences for d3pb5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pb5a_ b.50.1.2 (A:) automated matches {Cryphonectria parasitica [TaxId: 5116]}
stgsatttpidslddayitpvqigtpaqtlnldfdtgssdlwvfssettasevdgqtiyt
psksttakllsgatwsisygdgssssgdvytdtvsvggltvtgqavesakkvsssfteds
tidgllglafstlntvsptqqktffdnakasldspvftadlgyhapgtynfgfidttayt
gsitytavstkqgfwewtstgyavgsgtfkstsidgiadtgttllylpatvvsaywaqvs
gakssssvggyvfpcsatlpsftfgvgsarivipgdyidfgpistgssscfggiqssagi
ginifgdvalkaafvvfngattptlgfask

SCOPe Domain Coordinates for d3pb5a_:

Click to download the PDB-style file with coordinates for d3pb5a_.
(The format of our PDB-style files is described here.)

Timeline for d3pb5a_: