Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
Protein automated matches [190095] (14 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [186818] (3 PDB entries) |
Domain d3pb2f_: 3pb2 F: [183627] automated match to d1o5ka_ complexed with gol |
PDB Entry: 3pb2 (more details), 1.9 Å
SCOPe Domain Sequences for d3pb2f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pb2f_ c.1.10.1 (F:) automated matches {Thermotoga maritima [TaxId: 2336]} tmfrgvgtaivtpfkngeldlesyerlvryqlengvnalivlgttgesptvnedereklv srtleivdgkipvivgagtnstektlklvkqaeklgangvlvvtpyynkptqeglyqhyk yisertdlgivvynvpgrtgvnvlpetaariaadlknvvgikeanpdidqidrtvsltkq arsdfmvwsgnddrtfyllcaggdgvisvvsnvapkqmvelcaeyfsgnleksaevhakl rplmkalfvetnpipvkaalnlmgfienelrlplvpasektvellrnvlkesgll
Timeline for d3pb2f_: