SCOPe 2.08: Domain d3pb0b1: 3pb0 B:1-294

Lineage for d3pb0b1 (3pb0 B:1-294)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (28 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [186818] (3 PDB entries)

8. Domain d3pb0b1: 3pb0 B:1-294 [183618]
   Other proteins in same PDB: d3pb0a2, d3pb0b2, d3pb0c2, d3pb0d2
   automated match to d1o5ka_
   complexed with so4

Details for d3pb0b1

PDB Entry: 3pb0, 2 Å

PDB Description: Characterisation of the first monomeric dihydrodipicolinate synthase variant reveals evolutionary insights

PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3pb0b1:

Sequence; same for both SEQRES and ATOM records:

>d3pb0b1 c.1.10.1 (B:1-294) automated matches {Thermotoga maritima [TaxId: 2336]}
mfrgvgtaivtpfkngeldlesyerlvryqlengvnalivlgttgesptvnedereklvs
rtleivdgkipvivgagtnstektlklvkqaeklgangvlvvtpyynkptqeglyqhyky
isertdlgivvynvpgrtgvnvlpetaariaadlknvvgikeanpaaaqidrtvsltkqa
rsdfmvwsgnddrtfyllcaggdgvisvvsnvapkqmvelcaeyfsgnleksrevhrklr
plmkalfvetnpipvkaalnlmgfienelrlplvpasektvellrnvlkesgll

Timeline for d3pb0b1:

• d3pb0b1 first appeared in SCOPe 2.01, called d3pb0b_
  
• d3pb0b1 appears in SCOPe 2.07