![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.2: UEV domain [75383] (3 proteins) |
![]() | Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75385] (14 PDB entries) |
![]() | Domain d3p9ha1: 3p9h A:2-145 [183604] Other proteins in same PDB: d3p9ha2 automated match to d1kppa_ |
PDB Entry: 3p9h (more details), 1.8 Å
SCOPe Domain Sequences for d3p9ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p9ha1 d.20.1.2 (A:2-145) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]} avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyggsrelmnltgtipvpyrg ntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqsdll gliqvmivvfgdeppvfsrp
Timeline for d3p9ha1: