Lineage for d3p9ga_ (3p9g A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1407195Family d.20.1.2: UEV domain [75383] (3 proteins)
  6. 1407196Protein Tumor susceptibility gene 101 (TSG101) [75384] (1 species)
  7. 1407197Species Human (Homo sapiens) [TaxId:9606] [75385] (11 PDB entries)
  8. 1407201Domain d3p9ga_: 3p9g A: [183603]
    automated match to d1kppa_

Details for d3p9ga_

PDB Entry: 3p9g (more details), 1.8 Å

PDB Description: Crystal structure of the TSG101 UEV domain in complex with FA459 peptide
PDB Compounds: (A:) Tumor susceptibility gene 101 protein

SCOPe Domain Sequences for d3p9ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p9ga_ d.20.1.2 (A:) Tumor susceptibility gene 101 (TSG101) {Human (Homo sapiens) [TaxId: 9606]}
avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyggsrelmnltgtipvpyrg
ntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpqsdll
gliqvmivvfgdeppvfsrp

SCOPe Domain Coordinates for d3p9ga_:

Click to download the PDB-style file with coordinates for d3p9ga_.
(The format of our PDB-style files is described here.)

Timeline for d3p9ga_: