SCOPe 2.01: Domain d3p92e_: 3p92 E:

Lineage for d3p92e_ (3p92 E:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein automated matches [190046] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186767] (10 PDB entries)

8. Domain d3p92e_: 3p92 E: [183598]
   Other proteins in same PDB: d3p92a_
   automated match to d4tpii_
   complexed with ca

Details for d3p92e_

PDB Entry: 3p92, 1.6 Å

PDB Description: Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor variant (BPTI-K15R/R17G)

PDB Compounds: (E:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d3p92e_:

Sequence; same for both SEQRES and ATOM records:

>d3p92e_ g.8.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpcragiiryfynakaglcqtfvyggcrakrnnfksaedcmrtcgga

Timeline for d3p92e_:

• d3p92e_ is new in SCOPe 2.01-stable
  
• d3p92e_ appears in SCOPe 2.02
  
• d3p92e_ appears in the current release, SCOPe 2.08