SCOPe 2.01: Domain d3p92a_: 3p92 A:

Lineage for d3p92a_ (3p92 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Human (Homo sapiens), trypsin IV (brain isoform) [TaxId:9606] [69283] (6 PDB entries)

8. Domain d3p92a_: 3p92 A: [183597]
   Other proteins in same PDB: d3p92e_
   automated match to d1h4wa_
   complexed with ca

Details for d3p92a_

PDB Entry: 3p92, 1.6 Å

PDB Description: Human mesotrypsin complexed with bovine pancreatic trypsin inhibitor variant (BPTI-K15R/R17G)

PDB Compounds: (A:) PRSS3 protein

SCOPe Domain Sequences for d3p92a_:

Sequence; same for both SEQRES and ATOM records:

>d3p92a_ b.47.1.2 (A:) Trypsin(ogen) {Human (Homo sapiens), trypsin IV (brain isoform) [TaxId: 9606]}
ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans

Timeline for d3p92a_:

• d3p92a_ is new in SCOPe 2.01-stable
  
• d3p92a_ appears in SCOPe 2.02
  
• d3p92a_ appears in the current release, SCOPe 2.08