Lineage for d3p8za_ (3p8z A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145865Family c.66.1.25: mRNA cap methylase [88785] (3 proteins)
  6. 2145910Protein automated matches [190302] (8 species)
    not a true protein
  7. 2145913Species Dengue virus 3 [TaxId:11069] [189561] (2 PDB entries)
  8. 2145916Domain d3p8za_: 3p8z A: [183595]
    automated match to d1r6aa_
    protein/RNA complex; complexed with 36a, sah

Details for d3p8za_

PDB Entry: 3p8z (more details), 1.7 Å

PDB Description: Dengue Methyltransferase bound to a SAM-based inhibitor
PDB Compounds: (A:) non-structural protein 5

SCOPe Domain Sequences for d3p8za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p8za_ c.66.1.25 (A:) automated matches {Dengue virus 3 [TaxId: 11069]}
getlgekwkkklnqlsrkefdlykksgitevdrteakeglkrgetthhavsrgsaklqwf
vernmvipegrvidlgcgrggwsyycaglkkvtevrgytkggpgheepvpmstygwnivk
lmsgkdvfylppekcdtllcdigesspsptveesrtirvlkmvepwlknnqfcikvlnpy
mptviehlerlqrkhggmlvrnplsrnsthemywisngtgnivssvnmvsrlllnrftmt
hrrptiekdvdlgagtr

SCOPe Domain Coordinates for d3p8za_:

Click to download the PDB-style file with coordinates for d3p8za_.
(The format of our PDB-style files is described here.)

Timeline for d3p8za_: