Lineage for d3p8ud_ (3p8u D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1407410Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1407411Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1407957Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 1407958Protein automated matches [190526] (17 species)
    not a true protein
  7. 1408104Species Lobophyllia hemprichii [TaxId:46758] [187486] (12 PDB entries)
  8. 1408140Domain d3p8ud_: 3p8u D: [183594]
    automated match to d1mova_
    complexed with so3, so4

Details for d3p8ud_

PDB Entry: 3p8u (more details), 2.25 Å

PDB Description: Crystal structure of mEosFP in its green state
PDB Compounds: (D:) green to red photoconvertible gpf-like protein eosfp

SCOPe Domain Sequences for d3p8ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p8ud_ d.22.1.0 (D:) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
hgtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykak
ekgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn

SCOPe Domain Coordinates for d3p8ud_:

Click to download the PDB-style file with coordinates for d3p8ud_.
(The format of our PDB-style files is described here.)

Timeline for d3p8ud_: