| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
| Protein automated matches [190526] (26 species) not a true protein |
| Species Lobophyllia hemprichii [TaxId:46758] [187486] (25 PDB entries) |
| Domain d3p8ub_: 3p8u B: [183592] Other proteins in same PDB: d3p8uc2 automated match to d1mova_ complexed with so3, so4 |
PDB Entry: 3p8u (more details), 2.25 Å
SCOPe Domain Sequences for d3p8ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p8ub_ d.22.1.0 (B:) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
saikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
hygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfh
gtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykake
kgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn
Timeline for d3p8ub_:
View in 3DDomains from other chains: (mouse over for more information) d3p8ua_, d3p8uc1, d3p8uc2, d3p8ud_ |