Lineage for d3p8ra1 (3p8r A:3-294)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010549Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 protein domains)
  6. 2010594Protein automated matches [190489] (5 species)
    not a true protein
  7. 2010670Species Vibrio cholerae [TaxId:666] [189533] (1 PDB entry)
  8. 2010671Domain d3p8ra1: 3p8r A:3-294 [183590]
    Other proteins in same PDB: d3p8ra2
    automated match to d1rqja_

Details for d3p8ra1

PDB Entry: 3p8r (more details), 2.5 Å

PDB Description: crystal structure of polyprenyl synthase from vibrio cholerae
PDB Compounds: (A:) Geranyltranstransferase

SCOPe Domain Sequences for d3p8ra1:

Sequence, based on SEQRES records: (download)

>d3p8ra1 a.128.1.1 (A:3-294) automated matches {Vibrio cholerae [TaxId: 666]}
ealssyqqrnnqqldqwlnripfqtlplieamryglllggkrarpylvyitgqmlgcels
dldtpasavecihayslihddlpamdddelrrgkptchiqfdeatailtgdalqtlafti
laegdlsaagetqrvamlqalaeasgaqgmclgqaldlaaenrlisleeletihrnktga
lmrcairlgalaagekgramlphldryaeavglafqvqddildiisdtetlgkpqgsdqe
lnkstypallglegaqqkahtllqeallaleaipyntehleefaryvverkn

Sequence, based on observed residues (ATOM records): (download)

>d3p8ra1 a.128.1.1 (A:3-294) automated matches {Vibrio cholerae [TaxId: 666]}
ealssyqqrnnqqldqwlnripfqtlplieamryglllggkrarpylvyitgqmlgcels
dldtpasavecihayslihddlpamdddeatailtgdalqtlaftilaegdlsaagetqr
vamlqalaeasgaqgmclgqaldlaaenrlisleeletihrnktgalmrcairlgalaag
ekgramlphldryaeavglafqvqddildiisdkstypallglegaqqkahtllqealla
leaipyntehleefaryvverkn

SCOPe Domain Coordinates for d3p8ra1:

Click to download the PDB-style file with coordinates for d3p8ra1.
(The format of our PDB-style files is described here.)

Timeline for d3p8ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p8ra2