![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein Cyclin H (mcs2) [47959] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47960] (2 PDB entries) |
![]() | Domain d1kxua2: 1kxu A:162-286 [18359] |
PDB Entry: 1kxu (more details), 2.6 Å
SCOPe Domain Sequences for d1kxua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kxua2 a.74.1.1 (A:162-286) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} npyrpfegflidlktrypilenpeilrktaddflnrialtdayllytpsqialtailssa sragitmesylseslmlkenrtclsqlldimksmrnlvkkyepprseevavlkqklerch saela
Timeline for d1kxua2: