Lineage for d1kxu_2 (1kxu 162-286)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4853Fold a.74: Cyclin-like [47953] (1 superfamily)
  4. 4854Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
  5. 4855Family a.74.1.1: Cyclin [47955] (3 proteins)
  6. 4879Protein Cyclin H (mcs2) [47959] (1 species)
  7. 4880Species Human (Homo sapiens) [TaxId:9606] [47960] (2 PDB entries)
  8. 4884Domain d1kxu_2: 1kxu 162-286 [18359]

Details for d1kxu_2

PDB Entry: 1kxu (more details), 2.6 Å

PDB Description: cyclin h, a positive regulatory subunit of cdk activating kinase

SCOP Domain Sequences for d1kxu_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxu_2 a.74.1.1 (162-286) Cyclin H (mcs2) {Human (Homo sapiens)}
npyrpfegflidlktrypilenpeilrktaddflnrialtdayllytpsqialtailssa
sragitmesylseslmlkenrtclsqlldimksmrnlvkkyepprseevavlkqklerch
saela

SCOP Domain Coordinates for d1kxu_2:

Click to download the PDB-style file with coordinates for d1kxu_2.
(The format of our PDB-style files is described here.)

Timeline for d1kxu_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kxu_1