SCOPe 2.07: Domain d1kxua2: 1kxu A:162-286

Lineage for d1kxua2 (1kxu A:162-286)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 protein domains)

6. Protein Cyclin H (mcs2) [47959] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47960] (2 PDB entries)

8. Domain d1kxua2: 1kxu A:162-286 [18359]

Details for d1kxua2

PDB Entry: 1kxu, 2.6 Å

PDB Description: cyclin h, a positive regulatory subunit of cdk activating kinase

PDB Compounds: (A:) cyclin h

SCOPe Domain Sequences for d1kxua2:

Sequence; same for both SEQRES and ATOM records:

>d1kxua2 a.74.1.1 (A:162-286) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]}
npyrpfegflidlktrypilenpeilrktaddflnrialtdayllytpsqialtailssa
sragitmesylseslmlkenrtclsqlldimksmrnlvkkyepprseevavlkqklerch
saela

Timeline for d1kxua2:

• d1kxua2 first appeared (with stable ids) in SCOP 1.55, called d1kxu_2
  
• d1kxua2 appears in SCOPe 2.06