Lineage for d3p80a_ (3p80 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969026Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 969027Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 969230Protein Pentaerythritol tetranirate reductase [63900] (1 species)
  7. 969231Species Enterobacter cloacae [TaxId:550] [63901] (27 PDB entries)
    Uniprot P71278
  8. 969241Domain d3p80a_: 3p80 A: [183584]
    automated match to d1gvra_
    complexed with fmn, p80

Details for d3p80a_

PDB Entry: 3p80 (more details), 1.2 Å

PDB Description: Pentaerythritol tetranitrate reductase co-crystal structure containing bound (E)-1-(3'-hydroxyphenyl)-2-nitroethene
PDB Compounds: (A:) Pentaerythritol tetranitrate reductase

SCOPe Domain Sequences for d3p80a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p80a_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]}
aeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqi
saqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvs
asalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelh
sahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfq
nvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigag
aytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdy
psl

SCOPe Domain Coordinates for d3p80a_:

Click to download the PDB-style file with coordinates for d3p80a_.
(The format of our PDB-style files is described here.)

Timeline for d3p80a_: