Lineage for d3p7xd_ (3p7x D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2133854Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2133855Protein automated matches [190056] (165 species)
    not a true protein
  7. 2135010Species Staphylococcus aureus [TaxId:93061] [189763] (2 PDB entries)
  8. 2135014Domain d3p7xd_: 3p7x D: [183582]
    Other proteins in same PDB: d3p7xa2
    automated match to d1psqa_
    complexed with dtu, dtv, pg4, so4

Details for d3p7xd_

PDB Entry: 3p7x (more details), 1.96 Å

PDB Description: Crystal structure of an atypical two-cysteine peroxiredoxin (SAOUHSC_01822) from Staphylococcus aureus NCTC8325
PDB Compounds: (D:) Probable thiol peroxidase

SCOPe Domain Sequences for d3p7xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p7xd_ c.47.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 93061]}
teitfkggpihlkgqqinegdfapdftvldndlnqvtladyagkkklisvvpsidtgvcd
qqtrkfnsdaskeegivltisadlpfaqkrwcasagldnvitlsdhrdlsfgenygvvme
elrllaravfvldadnkvvykeivsegtdfpdfdaalaaykni

SCOPe Domain Coordinates for d3p7xd_:

Click to download the PDB-style file with coordinates for d3p7xd_.
(The format of our PDB-style files is described here.)

Timeline for d3p7xd_: