SCOPe 2.01: Domain d3p7xd_: 3p7x D:

Lineage for d3p7xd_ (3p7x D:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (35 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:93061] [189763] (1 PDB entry)

8. Domain d3p7xd_: 3p7x D: [183582]
   automated match to d1psqa_
   complexed with dtu, dtv, pg4, so4

Details for d3p7xd_

PDB Entry: 3p7x, 1.96 Å

PDB Description: Crystal structure of an atypical two-cysteine peroxiredoxin (SAOUHSC_01822) from Staphylococcus aureus NCTC8325

PDB Compounds: (D:) Probable thiol peroxidase

SCOPe Domain Sequences for d3p7xd_:

Sequence; same for both SEQRES and ATOM records:

>d3p7xd_ c.47.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 93061]}
teitfkggpihlkgqqinegdfapdftvldndlnqvtladyagkkklisvvpsidtgvcd
qqtrkfnsdaskeegivltisadlpfaqkrwcasagldnvitlsdhrdlsfgenygvvme
elrllaravfvldadnkvvykeivsegtdfpdfdaalaaykni

Timeline for d3p7xd_:

• d3p7xd_ is new in SCOPe 2.01-stable
  
• d3p7xd_ appears in SCOPe 2.02
  
• d3p7xd_ appears in the current release, SCOPe 2.08