Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (35 species) not a true protein |
Species Staphylococcus aureus [TaxId:93061] [189763] (1 PDB entry) |
Domain d3p7xd_: 3p7x D: [183582] automated match to d1psqa_ complexed with dtu, dtv, pg4, so4 |
PDB Entry: 3p7x (more details), 1.96 Å
SCOPe Domain Sequences for d3p7xd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p7xd_ c.47.1.0 (D:) automated matches {Staphylococcus aureus [TaxId: 93061]} teitfkggpihlkgqqinegdfapdftvldndlnqvtladyagkkklisvvpsidtgvcd qqtrkfnsdaskeegivltisadlpfaqkrwcasagldnvitlsdhrdlsfgenygvvme elrllaravfvldadnkvvykeivsegtdfpdfdaalaaykni
Timeline for d3p7xd_: