Lineage for d1kxu_1 (1kxu 11-161)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.74: Cyclin-like [47953] (1 superfamily) Superfamily a.74.1: Cyclin-like [47954] (3 families) 
Family a.74.1.1: Cyclin [47955] (3 proteins) 
Protein Cyclin H (mcs2) [47959] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47960] (2 PDB entries) 
Domain d1kxu_1: 1kxu 11-161 [18358]
Details for d1kxu_1
PDB Entry: 1kxu (more details), 2.6 Å
PDB Description: cyclin h, a positive regulatory subunit of cdk activating kinase
SCOP Domain Sequences for d1kxu_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kxu_1 a.74.1.1 (11-161) Cyclin H (mcs2) {Human (Homo sapiens)}
wtfsseeqlarlradanrkfrckavangkvlpndpvflepheemtlckyyekrllefcsv
fkpamprsvvgtacmyfkrfylnnsvmeyhpriimltcaflackvdefnvsspqfvgnlr
esplgqekaleqileyellliqqlnfhlivh
SCOP Domain Coordinates for d1kxu_1:
Click to download the PDB-style file with coordinates for d1kxu_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kxu_1:
- d1kxu_1 appears in SCOP 1.57
- d1kxu_1 appears in the current release, SCOPe 2.08, called d1kxua1
View in 3D
