Lineage for d1kxua1 (1kxu A:11-161)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.74: Cyclin-like [47953] (1 superfamily)
core: 5 helices; one helix is surrounded by the othersSuperfamily a.74.1: Cyclin-like [47954] (4 families) 
duplication: consists of two domains of this foldFamily a.74.1.1: Cyclin [47955] (9 proteins) 
Protein Cyclin H (mcs2) [47959] (1 species) Species Human (Homo sapiens) [TaxId:9606] [47960] (2 PDB entries) 
Domain d1kxua1: 1kxu A:11-161 [18358]
Details for d1kxua1
PDB Entry: 1kxu (more details), 2.6 Å
PDB Description: cyclin h, a positive regulatory subunit of cdk activating kinase
PDB Compounds: (A:) cyclin hSCOPe Domain Sequences for d1kxua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kxua1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]}
wtfsseeqlarlradanrkfrckavangkvlpndpvflepheemtlckyyekrllefcsv
fkpamprsvvgtacmyfkrfylnnsvmeyhpriimltcaflackvdefnvsspqfvgnlr
esplgqekaleqileyellliqqlnfhlivh
SCOPe Domain Coordinates for d1kxua1:
Click to download the PDB-style file with coordinates for d1kxua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kxua1:
- d1kxua1 first appeared (with stable ids) in SCOP 1.55, called d1kxu_1
- d1kxua1 appears in SCOPe 2.07
View in 3D
