Lineage for d1kxua1 (1kxu A:11-161)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718473Protein Cyclin H (mcs2) [47959] (1 species)
  7. 2718474Species Human (Homo sapiens) [TaxId:9606] [47960] (2 PDB entries)
  8. 2718475Domain d1kxua1: 1kxu A:11-161 [18358]

Details for d1kxua1

PDB Entry: 1kxu (more details), 2.6 Å

PDB Description: cyclin h, a positive regulatory subunit of cdk activating kinase
PDB Compounds: (A:) cyclin h

SCOPe Domain Sequences for d1kxua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kxua1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]}
wtfsseeqlarlradanrkfrckavangkvlpndpvflepheemtlckyyekrllefcsv
fkpamprsvvgtacmyfkrfylnnsvmeyhpriimltcaflackvdefnvsspqfvgnlr
esplgqekaleqileyellliqqlnfhlivh

SCOPe Domain Coordinates for d1kxua1:

Click to download the PDB-style file with coordinates for d1kxua1.
(The format of our PDB-style files is described here.)

Timeline for d1kxua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kxua2