Lineage for d3p7xa_ (3p7x A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1169725Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1169726Protein automated matches [190056] (50 species)
    not a true protein
  7. 1169887Species Staphylococcus aureus [TaxId:93061] [189763] (1 PDB entry)
  8. 1169888Domain d3p7xa_: 3p7x A: [183579]
    automated match to d1psqa_
    complexed with dtu, dtv, pg4, so4

Details for d3p7xa_

PDB Entry: 3p7x (more details), 1.96 Å

PDB Description: Crystal structure of an atypical two-cysteine peroxiredoxin (SAOUHSC_01822) from Staphylococcus aureus NCTC8325
PDB Compounds: (A:) Probable thiol peroxidase

SCOPe Domain Sequences for d3p7xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p7xa_ c.47.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 93061]}
gsmteitfkggpihlkgqqinegdfapdftvldndlnqvtladyagkkklisvvpsidtg
vcdqqtrkfnsdaskeegivltisadlpfaqkrwcasagldnvitlsdhrdlsfgenygv
vmeelrllaravfvldadnkvvykeivsegtdfpdfdaalaaykni

SCOPe Domain Coordinates for d3p7xa_:

Click to download the PDB-style file with coordinates for d3p7xa_.
(The format of our PDB-style files is described here.)

Timeline for d3p7xa_: