Lineage for d3p75a_ (3p75 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 949213Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 949214Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 949370Protein automated matches [190761] (2 species)
    not a true protein
  7. 949371Species Staphylococcus aureus [TaxId:1280] [188650] (14 PDB entries)
  8. 949382Domain d3p75a_: 3p75 A: [183572]
    automated match to d1tr5a_
    complexed with ca, thp

Details for d3p75a_

PDB Entry: 3p75 (more details), 1.9 Å

PDB Description: crystal structure of staphylococcal nuclease variant delta+phs v104d at cryogenic temperature
PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d3p75a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p75a_ b.40.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
evefdkgqrtdkygrglayiyadgkmvnealdrqglakvayvykgnntheqllrkaeaqa
kkeklniws

SCOPe Domain Coordinates for d3p75a_:

Click to download the PDB-style file with coordinates for d3p75a_.
(The format of our PDB-style files is described here.)

Timeline for d3p75a_: