Lineage for d3p74a_ (3p74 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1816697Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 1816698Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 1817040Protein Pentaerythritol tetranirate reductase [63900] (1 species)
  7. 1817041Species Enterobacter cloacae [TaxId:550] [63901] (27 PDB entries)
    Uniprot P71278
  8. 1817048Domain d3p74a_: 3p74 A: [183571]
    automated match to d1gvra_
    complexed with fmn; mutant

Details for d3p74a_

PDB Entry: 3p74 (more details), 1.2 Å

PDB Description: H181N mutant of pentaerythritol tetranitrate reductase containing a C-terminal His8-tag
PDB Compounds: (A:) Pentaerythritol tetranitrate reductase

SCOPe Domain Sequences for d3p74a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p74a_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]}
klftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqisa
qakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsas
alnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelnsa
hgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqnv
dngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigagay
taekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyps
lhh

SCOPe Domain Coordinates for d3p74a_:

Click to download the PDB-style file with coordinates for d3p74a_.
(The format of our PDB-style files is described here.)

Timeline for d3p74a_: