| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (9 proteins) |
| Protein Cyclin H (mcs2) [47959] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [47960] (2 PDB entries) |
| Domain d1jkwa2: 1jkw A:162-287 [18357] |
PDB Entry: 1jkw (more details), 2.6 Å
SCOPe Domain Sequences for d1jkwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jkwa2 a.74.1.1 (A:162-287) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]}
npyrpfegflidlktrypilenpeilrktaddflnrialtdayllytpsqialtailssa
sragitmesylseslmlkenrtclsqlldimksmrnlvkkyepprseevavlkqkldrch
saelal
Timeline for d1jkwa2: