SCOPe 2.01: Domain d3p72a_: 3p72 A:

Lineage for d3p72a_ (3p72 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.7: Ngr ectodomain-like [75142] (6 proteins)
   this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain

6. Protein von Willebrand factor binding domain of glycoprotein Ib alpha [75143] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75144] (10 PDB entries)

8. Domain d3p72a_: 3p72 A: [183569]
   automated match to d1m0za_
   complexed with cl

Details for d3p72a_

PDB Entry: 3p72, 1.9 Å

PDB Description: structure of platelet glycoprotein 1b alpha with a bound peptide inhibitor

PDB Compounds: (A:) platelet glycoprotein ib alpha chain

SCOPe Domain Sequences for d3p72a_:

Sequence; same for both SEQRES and ATOM records:

>d3p72a_ c.10.2.7 (A:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}
hpicevskvashlevncdkrqltalppdlpkdttilhlsenllytfslatlmpytrltql
nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal
rglgelqelylkgnelktlppglltptpkleklslannqltelpagllnglenldtlllq
enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqgvdvkamt
snvasvqcdnsdkfpvykypgkgcplvpr

Timeline for d3p72a_:

• d3p72a_ is new in SCOPe 2.01-stable
  
• d3p72a_ appears in SCOPe 2.02
  
• d3p72a_ appears in the current release, SCOPe 2.08, called d3p72a1