Lineage for d3p71c_ (3p71 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998136Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2998142Protein Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha [143933] (1 species)
  7. 2998143Species Human (Homo sapiens) [TaxId:9606] [143934] (12 PDB entries)
    Uniprot P67775 2-294
  8. 2998148Domain d3p71c_: 3p71 C: [183568]
    Other proteins in same PDB: d3p71t_
    automated match to d2nylc1
    complexed with an6, mn, peg

Details for d3p71c_

PDB Entry: 3p71 (more details), 2.7 Å

PDB Description: Crystal structure of the complex of LCMT-1 and PP2A
PDB Compounds: (C:) Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform

SCOPe Domain Sequences for d3p71c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p71c_ d.159.1.3 (C:) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]}
dekvftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgq
fhdlmelfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesr
qitqvygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhir
aldrlqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrah
qlvmegynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpaphvtrrtpd
yfl

SCOPe Domain Coordinates for d3p71c_:

Click to download the PDB-style file with coordinates for d3p71c_.
(The format of our PDB-style files is described here.)

Timeline for d3p71c_: