Class a: All alpha proteins [46456] (286 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin H (mcs2) [47959] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47960] (2 PDB entries) |
Domain d1jkwa1: 1jkw A:11-161 [18356] |
PDB Entry: 1jkw (more details), 2.6 Å
SCOPe Domain Sequences for d1jkwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jkwa1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} wtfsseeqlarlradanrkfrckavangkvlpndpvflepheemtlckyyekrllefcsv fkpamprsvvgtacmyfkrfylnnsvmeyhpriimltcaflackvdefnvsspqfvgnlr esplgqekaleqileyellliqqlnfhlivh
Timeline for d1jkwa1: