SCOPe 2.08: Domain d1jkwa1: 1jkw A:11-161

Lineage for d1jkwa1 (1jkw A:11-161)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin H (mcs2) [47959] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47960] (2 PDB entries)

8. Domain d1jkwa1: 1jkw A:11-161 [18356]

Details for d1jkwa1

PDB Entry: 1jkw, 2.6 Å

PDB Description: structure of cyclin mcs2

PDB Compounds: (A:) cyclin h

SCOPe Domain Sequences for d1jkwa1:

Sequence; same for both SEQRES and ATOM records:

>d1jkwa1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]}
wtfsseeqlarlradanrkfrckavangkvlpndpvflepheemtlckyyekrllefcsv
fkpamprsvvgtacmyfkrfylnnsvmeyhpriimltcaflackvdefnvsspqfvgnlr
esplgqekaleqileyellliqqlnfhlivh

Timeline for d1jkwa1:

• d1jkwa1 first appeared (with stable ids) in SCOP 1.55, called d1jkw_1
  
• d1jkwa1 appears in SCOPe 2.07