Lineage for d3p6pa_ (3p6p A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005161Protein Cytochrome P450-CAM [48266] (1 species)
  7. 2005162Species Pseudomonas putida [TaxId:303] [48267] (115 PDB entries)
    Uniprot P00183
  8. 2005235Domain d3p6pa_: 3p6p A: [183559]
    automated match to d1t87a_
    complexed with a6b, hem, k

Details for d3p6pa_

PDB Entry: 3p6p (more details), 1.9 Å

PDB Description: Crystal Structure of Cytochrome P450cam crystallized in the presence of a tethered substrate analog AdaC1-C6-Bio
PDB Compounds: (A:) Camphor 5-monooxygenase

SCOPe Domain Sequences for d3p6pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p6pa_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatr
gqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkl
enriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrp
dgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllv
ggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyef
hgvqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarrei
ivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d3p6pa_:

Click to download the PDB-style file with coordinates for d3p6pa_.
(The format of our PDB-style files is described here.)

Timeline for d3p6pa_: