Lineage for d1vin_2 (1vin 309-432)
- Root: SCOP 1.71
Class a: All alpha proteins [46456] (226 folds) 
Fold a.74: Cyclin-like [47953] (1 superfamily)
core: 5 helices; one helix is surrounded by the othersSuperfamily a.74.1: Cyclin-like [47954] (3 families) 
duplication: consists of two domains of this fold
Family a.74.1.1: Cyclin [47955] (4 proteins) Protein Cyclin A [47956] (2 species) 
Species Cow (Bos taurus) [TaxId:9913] [47958] (1 PDB entry) 
Domain d1vin_2: 1vin 309-432 [18355]
mutant
Details for d1vin_2
PDB Entry: 1vin (more details), 2 Å
PDB Description: bovine cyclin a3
SCOP Domain Sequences for d1vin_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vin_2 a.74.1.1 (309-432) Cyclin A {Cow (Bos taurus)}
ptinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvt
gqswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppe
tlnl
SCOP Domain Coordinates for d1vin_2:
Click to download the PDB-style file with coordinates for d1vin_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vin_2:
- d1vin_2 first appeared (with stable ids) in SCOP 1.55
- d1vin_2 appears in SCOP 1.69
- d1vin_2 is called d1vina2 in SCOP 1.73
- d1vin_2 appears in the current release, SCOPe 2.08, called d1vina2
View in 3D
