Lineage for d3p63a_ (3p63 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1638761Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 1638762Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 1638886Protein automated matches [190231] (8 species)
    not a true protein
  7. 1638919Species Mastigocladus laminosus [TaxId:83541] [188017] (2 PDB entries)
  8. 1638922Domain d3p63a_: 3p63 A: [183547]
    automated match to d1czpa_
    complexed with fes

Details for d3p63a_

PDB Entry: 3p63 (more details), 2.3 Å

PDB Description: Structure of M. laminosus Ferredoxin with a shorter L1,2 loop
PDB Compounds: (A:) ferredoxin

SCOPe Domain Sequences for d3p63a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p63a_ d.15.4.1 (A:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
atykvtlinptgnktievpddqyildaaeeagidlpyscragacstcagklisgtvdqsd
qsfldddqieagyvltcvayptsdcviethkeeel

SCOPe Domain Coordinates for d3p63a_:

Click to download the PDB-style file with coordinates for d3p63a_.
(The format of our PDB-style files is described here.)

Timeline for d3p63a_: