![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein Cyclin A [47956] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [47958] (10 PDB entries) |
![]() | Domain d1vina1: 1vin A:181-308 [18354] Other proteins in same PDB: d1vina3 |
PDB Entry: 1vin (more details), 2 Å
SCOPe Domain Sequences for d1vina1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vina1 a.74.1.1 (A:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk vlafdlaa
Timeline for d1vina1: