Lineage for d3p5ic_ (3p5i C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608257Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)
  8. 2608323Domain d3p5ic_: 3p5i C: [183535]
    automated match to d1k9jb_
    complexed with ca

Details for d3p5ic_

PDB Entry: 3p5i (more details), 1.8 Å

PDB Description: structure of the carbohydrate-recognition domain of human langerin with 6-so4-gal-glcnac
PDB Compounds: (C:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3p5ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p5ic_ d.169.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywiglt
kagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktfl
fickrpyvp

SCOPe Domain Coordinates for d3p5ic_:

Click to download the PDB-style file with coordinates for d3p5ic_.
(The format of our PDB-style files is described here.)

Timeline for d3p5ic_: