SCOPe 2.04: Domain d3p5hd_: 3p5h D:

Lineage for d3p5hd_ (3p5h D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (61 PDB entries)

8. Domain d3p5hd_: 3p5h D: [183532]
   automated match to d1k9jb_
   complexed with bgc, ca

Details for d3p5hd_

PDB Entry: 3p5h, 1.61 Å

PDB Description: structure of the carbohydrate-recognition domain of human langerin with laminaritriose

PDB Compounds: (D:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3p5hd_:

Sequence; same for both SEQRES and ATOM records:

>d3p5hd_ d.169.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywiglt
kagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktfl
fickrpyv

Timeline for d3p5hd_:

• d3p5hd_ first appeared in SCOPe 2.01
  
• d3p5hd_ appears in SCOPe 2.03
  
• d3p5hd_ appears in SCOPe 2.05
  
• d3p5hd_ appears in the current release, SCOPe 2.08