Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (8 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (56 PDB entries) |
Domain d3p5gc_: 3p5g C: [183527] automated match to d1k9jb_ complexed with ca, fuc |
PDB Entry: 3p5g (more details), 1.6 Å
SCOPe Domain Sequences for d3p5gc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p5gc_ d.169.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywiglt kagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktfl fickrpyvp
Timeline for d3p5gc_: