SCOPe 2.06: Domain d3p5ga_: 3p5g A:

Lineage for d3p5ga_ (3p5g A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)

8. Domain d3p5ga_: 3p5g A: [183525]
   automated match to d1k9jb_
   complexed with ca, fuc

Details for d3p5ga_

PDB Entry: 3p5g, 1.6 Å

PDB Description: structure of the carbohydrate-recognition domain of human langerin with blood group b trisaccharide (gal alpha1-3(fuc alpha1-2)gal)

PDB Compounds: (A:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3p5ga_:

Sequence; same for both SEQRES and ATOM records:

>d3p5ga_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
agmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktflf
ickrpyvp

Timeline for d3p5ga_:

• d3p5ga_ first appeared in SCOPe 2.01
  
• d3p5ga_ appears in SCOPe 2.05
  
• d3p5ga_ appears in SCOPe 2.07
  
• d3p5ga_ appears in the current release, SCOPe 2.08