SCOPe 2.05: Domain d3p5dc_: 3p5d C:

Lineage for d3p5dc_ (3p5d C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (65 PDB entries)

8. Domain d3p5dc_: 3p5d C: [183515]
   automated match to d1k9jb_
   complexed with ca, man

Details for d3p5dc_

PDB Entry: 3p5d, 1.8 Å

PDB Description: structure of the carbohydrate-recognition domain of human langerin with man5 (man alpha1-3(man alpha1-6)man alpha1-6)(man- alpha1-3)man

PDB Compounds: (C:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3p5dc_:

Sequence; same for both SEQRES and ATOM records:

>d3p5dc_ d.169.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigl
tkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktf
lfickrpyvp

Timeline for d3p5dc_:

• d3p5dc_ first appeared in SCOPe 2.01
  
• d3p5dc_ appears in SCOPe 2.04
  
• d3p5dc_ appears in SCOPe 2.06
  
• d3p5dc_ appears in the current release, SCOPe 2.08