SCOP 1.61: Domain d1fvvb2: 1fvv B:310-432

Lineage for d1fvvb2 (1fvv B:310-432)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)

5. Family a.74.1.1: Cyclin [47955] (4 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (7 PDB entries)

8. Domain d1fvvb2: 1fvv B:310-432 [18351]
   Other proteins in same PDB: d1fvva_, d1fvvc_

Details for d1fvvb2

PDB Entry: 1fvv, 2.8 Å

PDB Description: the structure of cdk2/cyclin a in complex with an oxindole inhibitor

SCOP Domain Sequences for d1fvvb2:

Sequence; same for both SEQRES and ATOM records:

>d1fvvb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens)}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d1fvvb2:

• d1fvvb2 first appeared (with stable ids) in SCOP 1.55
  
• d1fvvb2 appears in SCOP 1.59
  
• d1fvvb2 appears in SCOP 1.63
  
• d1fvvb2 appears in the current release, SCOPe 2.08