Lineage for d3p4oe_ (3p4o E:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 931882Protein beta2-microglobulin [88600] (5 species)
  7. 932374Species Mouse (Mus musculus) [TaxId:10090] [88603] (142 PDB entries)
    Uniprot P01887
  8. 932461Domain d3p4oe_: 3p4o E: [183504]
    automated match to d1biib_
    complexed with ace; mutant

Details for d3p4oe_

PDB Entry: 3p4o (more details), 2.3 Å

PDB Description: Crystal Structure of H2-Kb in complex with the mutant NP205-LCMV-V3A epitope YTAKYPNL, an 8-mer modified peptide from the LCMV
PDB Compounds: (E:) Beta-2-microglobulin

SCOPe Domain Sequences for d3p4oe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p4oe_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d3p4oe_:

Click to download the PDB-style file with coordinates for d3p4oe_.
(The format of our PDB-style files is described here.)

Timeline for d3p4oe_: