SCOPe 2.08: Domain d3p4ob_: 3p4o B:

Lineage for d3p4ob_ (3p4o B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
   Uniprot P01887

8. Domain d3p4ob_: 3p4o B: [183503]
   automated match to d1biib_
   complexed with ace; mutant

Details for d3p4ob_

PDB Entry: 3p4o, 2.3 Å

PDB Description: Crystal Structure of H2-Kb in complex with the mutant NP205-LCMV-V3A epitope YTAKYPNL, an 8-mer modified peptide from the LCMV

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d3p4ob_:

Sequence; same for both SEQRES and ATOM records:

>d3p4ob_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d3p4ob_:

• d3p4ob_ first appeared in SCOPe 2.01
  
• d3p4ob_ appears in SCOPe 2.07