SCOPe 2.06: Domain d3p3va_: 3p3v A:

Lineage for d3p3va_ (3p3v A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.38: PTS IIb component [52727] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 6 strands, order 324156

4. Superfamily c.38.1: PTS IIb component [52728] (2 families)

5. Family c.38.1.0: automated matches [191563] (1 protein)
   not a true family

6. Protein automated matches [190977] (5 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:301447] [189529] (1 PDB entry)

8. Domain d3p3va_: 3p3v A: [183491]
   Other proteins in same PDB: d3p3vb2
   automated match to d1blea_
   complexed with peg, pge

Details for d3p3va_

PDB Entry: 3p3v, 1.65 Å

PDB Description: crystal structure of a pts dependent n-acetyl-galactosamine-iib component (agav, spy_0631) from streptococcus pyogenes at 1.65 a resolution

PDB Compounds: (A:) PTS system, N-acetylgalactosamine-specific IIB component

SCOPe Domain Sequences for d3p3va_:

Sequence; same for both SEQRES and ATOM records:

>d3p3va_ c.38.1.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 301447]}
mtqpniimtrvderlihgqgqlwvkflncntvivandavsedkiqqslmktvipssiair
ffsiqkvidiihkaspaqsifivvkdlqdakllveggvpiteinignihktddkvaitqf
islgetdksairclahdhhvvfntkttpagnsasdvdildyi

Timeline for d3p3va_:

• d3p3va_ first appeared in SCOPe 2.01
  
• d3p3va_ appears in SCOPe 2.05
  
• d3p3va_ appears in SCOPe 2.07
  
• d3p3va_ appears in the current release, SCOPe 2.08