| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.38: PTS IIb component [52727] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 6 strands, order 324156 |
Superfamily c.38.1: PTS IIb component [52728] (2 families) ![]() |
| Family c.38.1.0: automated matches [191563] (1 protein) not a true family |
| Protein automated matches [190977] (5 species) not a true protein |
| Species Streptococcus pyogenes [TaxId:301447] [189529] (1 PDB entry) |
| Domain d3p3va_: 3p3v A: [183491] Other proteins in same PDB: d3p3vb2 automated match to d1blea_ complexed with peg, pge |
PDB Entry: 3p3v (more details), 1.65 Å
SCOPe Domain Sequences for d3p3va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p3va_ c.38.1.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 301447]}
mtqpniimtrvderlihgqgqlwvkflncntvivandavsedkiqqslmktvipssiair
ffsiqkvidiihkaspaqsifivvkdlqdakllveggvpiteinignihktddkvaitqf
islgetdksairclahdhhvvfntkttpagnsasdvdildyi
Timeline for d3p3va_: