Lineage for d3p3va_ (3p3v A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873203Fold c.38: PTS IIb component [52727] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 6 strands, order 324156
  4. 2873204Superfamily c.38.1: PTS IIb component [52728] (2 families) (S)
  5. 2873215Family c.38.1.0: automated matches [191563] (1 protein)
    not a true family
  6. 2873216Protein automated matches [190977] (5 species)
    not a true protein
  7. 2873226Species Streptococcus pyogenes [TaxId:301447] [189529] (1 PDB entry)
  8. 2873227Domain d3p3va_: 3p3v A: [183491]
    Other proteins in same PDB: d3p3vb2
    automated match to d1blea_
    complexed with peg, pge

Details for d3p3va_

PDB Entry: 3p3v (more details), 1.65 Å

PDB Description: crystal structure of a pts dependent n-acetyl-galactosamine-iib component (agav, spy_0631) from streptococcus pyogenes at 1.65 a resolution
PDB Compounds: (A:) PTS system, N-acetylgalactosamine-specific IIB component

SCOPe Domain Sequences for d3p3va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p3va_ c.38.1.0 (A:) automated matches {Streptococcus pyogenes [TaxId: 301447]}
mtqpniimtrvderlihgqgqlwvkflncntvivandavsedkiqqslmktvipssiair
ffsiqkvidiihkaspaqsifivvkdlqdakllveggvpiteinignihktddkvaitqf
islgetdksairclahdhhvvfntkttpagnsasdvdildyi

SCOPe Domain Coordinates for d3p3va_:

Click to download the PDB-style file with coordinates for d3p3va_.
(The format of our PDB-style files is described here.)

Timeline for d3p3va_: