Lineage for d1jstd2 (1jst D:310-432)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772181Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 772182Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 772183Family a.74.1.1: Cyclin [47955] (8 proteins)
  6. 772194Protein Cyclin A [47956] (2 species)
  7. 772294Species Human (Homo sapiens) [TaxId:9606] [47957] (35 PDB entries)
    Uniprot P20248 175-432
  8. 772376Domain d1jstd2: 1jst D:310-432 [18349]
    Other proteins in same PDB: d1jsta_, d1jstc_
    complexed with atp, mn

Details for d1jstd2

PDB Entry: 1jst (more details), 2.6 Å

PDB Description: phosphorylated cyclin-dependent kinase-2 bound to cyclin a
PDB Compounds: (D:) cyclin a

SCOP Domain Sequences for d1jstd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jstd2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOP Domain Coordinates for d1jstd2:

Click to download the PDB-style file with coordinates for d1jstd2.
(The format of our PDB-style files is described here.)

Timeline for d1jstd2: