![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.88: Mss4-like [51315] (1 superfamily) complex fold made of several coiled beta-sheets |
![]() | Superfamily b.88.1: Mss4-like [51316] (4 families) ![]() duplication: tandem repeat of two similar structural motifs |
![]() | Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins) contains an insertion of alpha helical hairpin; lacks zinc-binding site |
![]() | Protein automated matches [190167] (2 species) not a true protein |
![]() | Species Plasmodium falciparum [TaxId:36329] [189794] (1 PDB entry) |
![]() | Domain d3p3ka_: 3p3k A: [183488] automated match to d1txja_ |
PDB Entry: 3p3k (more details), 2.55 Å
SCOPe Domain Sequences for d3p3ka_:
Sequence, based on SEQRES records: (download)
>d3p3ka_ b.88.1.2 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]} mefrmkvfkdvftndevcsdsyvqqdpfevpefreiafevksnkrikgnedygiadnsed avegmgadvehvidivdsfqltstafskkeysayiknymqkvakyleekkpdrveifktk aqpfikhiltnfddfefymgesldmeagiiysyykgeeitprfvyisdglfeekylehhh hh
>d3p3ka_ b.88.1.2 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]} mefrmkvfkdvftndevcsdsyvqqdpfevpefreiafevksnkrikhvidivdsfqlts tafskkeysayiknymqkvakyleekkpdrveifktkaqpfikhiltnfddfefymgesl dmeagiiysyykgeeitprfvyisdglfeekylehhhhh
Timeline for d3p3ka_: