SCOPe 2.02: Domain d3p3ka_: 3p3k A:

Lineage for d3p3ka_ (3p3k A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.88: Mss4-like [51315] (1 superfamily)
   complex fold made of several coiled beta-sheets

4. Superfamily b.88.1: Mss4-like [51316] (4 families)
   duplication: tandem repeat of two similar structural motifs

5. Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins)
   contains an insertion of alpha helical hairpin; lacks zinc-binding site

6. Protein automated matches [190167] (2 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [189794] (1 PDB entry)

8. Domain d3p3ka_: 3p3k A: [183488]
   automated match to d1txja_

Details for d3p3ka_

PDB Entry: 3p3k, 2.55 Å

PDB Description: The crystal structure of translationally controlled tumor protein (TCTP) of Plasmodium falciparum

PDB Compounds: (A:) Translationally-controlled tumor protein homolog

SCOPe Domain Sequences for d3p3ka_:

Sequence, based on SEQRES records:

>d3p3ka_ b.88.1.2 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mefrmkvfkdvftndevcsdsyvqqdpfevpefreiafevksnkrikgnedygiadnsed
avegmgadvehvidivdsfqltstafskkeysayiknymqkvakyleekkpdrveifktk
aqpfikhiltnfddfefymgesldmeagiiysyykgeeitprfvyisdglfeekylehhh
hh

Sequence, based on observed residues (ATOM records):

>d3p3ka_ b.88.1.2 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mefrmkvfkdvftndevcsdsyvqqdpfevpefreiafevksnkrikhvidivdsfqlts
tafskkeysayiknymqkvakyleekkpdrveifktkaqpfikhiltnfddfefymgesl
dmeagiiysyykgeeitprfvyisdglfeekylehhhhh

Timeline for d3p3ka_:

• d3p3ka_ first appeared in SCOPe 2.01
  
• d3p3ka_ appears in SCOPe 2.03
  
• d3p3ka_ appears in the current release, SCOPe 2.08, called d3p3ka1