![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.88: Mss4-like [51315] (2 superfamilies) complex fold made of several coiled beta-sheets |
![]() | Superfamily b.88.1: Mss4-like [51316] (5 families) ![]() duplication: tandem repeat of two similar structural motifs |
![]() | Family b.88.1.2: Translationally controlled tumor protein TCTP (histamine-releasing factor) [63873] (2 proteins) contains an insertion of alpha helical hairpin; lacks zinc-binding site automatically mapped to Pfam PF00838 |
![]() | Protein automated matches [190167] (2 species) not a true protein |
![]() | Species Plasmodium falciparum [TaxId:36329] [189794] (1 PDB entry) |
![]() | Domain d3p3ka1: 3p3k A:5-175 [183488] Other proteins in same PDB: d3p3ka2, d3p3ka3 automated match to d1txja_ |
PDB Entry: 3p3k (more details), 2.55 Å
SCOPe Domain Sequences for d3p3ka1:
Sequence, based on SEQRES records: (download)
>d3p3ka1 b.88.1.2 (A:5-175) automated matches {Plasmodium falciparum [TaxId: 36329]} mkvfkdvftndevcsdsyvqqdpfevpefreiafevksnkrikgnedygiadnsedaveg mgadvehvidivdsfqltstafskkeysayiknymqkvakyleekkpdrveifktkaqpf ikhiltnfddfefymgesldmeagiiysyykgeeitprfvyisdglfeeky
>d3p3ka1 b.88.1.2 (A:5-175) automated matches {Plasmodium falciparum [TaxId: 36329]} mkvfkdvftndevcsdsyvqqdpfevpefreiafevksnkrikhvidivdsfqltstafs kkeysayiknymqkvakyleekkpdrveifktkaqpfikhiltnfddfefymgesldmea giiysyykgeeitprfvyisdglfeeky
Timeline for d3p3ka1: