Lineage for d3p31a_ (3p31 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1688640Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 1688641Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
    automatically mapped to Pfam PF00600
  5. 1688642Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
    C-terminal part of Pfam PF00600
  6. 1688647Protein automated matches [190936] (6 species)
    not a true protein
  7. 1688685Species Influenza A virus [TaxId:680789] [189731] (3 PDB entries)
  8. 1688686Domain d3p31a_: 3p31 A: [183479]
    automated match to d2gx9a1
    complexed with scn

Details for d3p31a_

PDB Entry: 3p31 (more details), 2.45 Å

PDB Description: Crystal structure of the NS1 effector domain from influenza A/Vietnam/1203/2004 (H5N1) virus
PDB Compounds: (A:) nonstructural protein 1

SCOPe Domain Sequences for d3p31a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p31a_ d.299.1.1 (A:) automated matches {Influenza A virus [TaxId: 680789]}
pasryltdmtleemsrdwfmlmpkqkvagslcikmdqaimdktiilkanfsvifdrletl
illrafteegaivgeisplpslpghtgedvknaigvligglewndntvrvtetiqrfawr

SCOPe Domain Coordinates for d3p31a_:

Click to download the PDB-style file with coordinates for d3p31a_.
(The format of our PDB-style files is described here.)

Timeline for d3p31a_: