Lineage for d3p2lb_ (3p2l B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1584360Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1584361Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. Protein automated matches [190149] (7 species)
    not a true protein
  7. 1584668Species Francisella tularensis [TaxId:177416] [189492] (1 PDB entry)
  8. 1584670Domain d3p2lb_: 3p2l B: [183473]
    automated match to d1tyfa_
    complexed with edo, gol, mg, peg, po4

Details for d3p2lb_

PDB Entry: 3p2l (more details), 2.29 Å

PDB Description: Crystal Structure of ATP-dependent Clp protease subunit P from Francisella tularensis
PDB Compounds: (B:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3p2lb_:

Sequence, based on SEQRES records: (download)

>d3p2lb_ c.14.1.1 (B:) automated matches {Francisella tularensis [TaxId: 177416]}
lvptviektaggerafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyf
yinspggmvtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimi
hqplggfrgqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeaka
yglidhviesre

Sequence, based on observed residues (ATOM records): (download)

>d3p2lb_ c.14.1.1 (B:) automated matches {Francisella tularensis [TaxId: 177416]}
lvptviafdiysrllkerivflngevndhsanlviaqllflesedpdkdiyfyinspggm
vtagmgvydtmqfikpdvsticiglaasmgslllaggakgkryslpssqimihqplggfr
gqasdieihaknilrikdrlnkvlahhtgqdletivkdtdrdnfmmadeakayglidhvi
esre

SCOPe Domain Coordinates for d3p2lb_:

Click to download the PDB-style file with coordinates for d3p2lb_.
(The format of our PDB-style files is described here.)

Timeline for d3p2lb_: