Lineage for d3p2cb_ (3p2c B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722269Family a.102.1.8: CPF0428-like [158737] (3 proteins)
    Pfam PF06824; DUF1237
  6. 2722284Protein automated matches [191186] (1 species)
    not a true protein
  7. 2722285Species Bacteroides ovatus [TaxId:411476] [189465] (2 PDB entries)
  8. 2722287Domain d3p2cb_: 3p2c B: [183471]
    automated match to d2p0va1
    complexed with edo, pge

Details for d3p2cb_

PDB Entry: 3p2c (more details), 1.6 Å

PDB Description: crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution
PDB Compounds: (B:) Putative glycosyl hydrolase

SCOPe Domain Sequences for d3p2cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p2cb_ a.102.1.8 (B:) automated matches {Bacteroides ovatus [TaxId: 411476]}
dnrpeisnrlfrsnavekeilrvqkllknaklawmftncfpntldttvhfrkgsdgkpdt
fvytgdihamwlrdsgaqvwpyvqlansdpelkemlagvilrqfkcinidpyanafndga
ipdghwmsdltdmkpelherkweidslcyplrlayhywkttgdasifneewiqaitnvlk
tfkeqqrkdgvgpykfqrkteraldtvsndglgapvkpvglivssfrpsddattlqflvp
snffavsslrkaaeilekvnkktalskeckdlaqevetalkkyavynhpkygkiyafevd
gfgnhhlmddanvpsllampylgdvnvndpiyqntrrfvwsednpyffkgkagegiggph
igydmvwpmsimmkaftsqndaeiktcikmlmdtdagtgfmhesfhkdnpkkftrawfaw
qntlfgelilklvnegkvdllnsiq

SCOPe Domain Coordinates for d3p2cb_:

Click to download the PDB-style file with coordinates for d3p2cb_.
(The format of our PDB-style files is described here.)

Timeline for d3p2cb_: