![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) ![]() |
![]() | Family a.102.1.8: CPF0428-like [158737] (3 proteins) Pfam PF06824; DUF1237 |
![]() | Protein automated matches [191186] (1 species) not a true protein |
![]() | Species Bacteroides ovatus [TaxId:411476] [189465] (2 PDB entries) |
![]() | Domain d3p2cb_: 3p2c B: [183471] automated match to d2p0va1 complexed with edo, pge |
PDB Entry: 3p2c (more details), 1.6 Å
SCOPe Domain Sequences for d3p2cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p2cb_ a.102.1.8 (B:) automated matches {Bacteroides ovatus [TaxId: 411476]} dnrpeisnrlfrsnavekeilrvqkllknaklawmftncfpntldttvhfrkgsdgkpdt fvytgdihamwlrdsgaqvwpyvqlansdpelkemlagvilrqfkcinidpyanafndga ipdghwmsdltdmkpelherkweidslcyplrlayhywkttgdasifneewiqaitnvlk tfkeqqrkdgvgpykfqrkteraldtvsndglgapvkpvglivssfrpsddattlqflvp snffavsslrkaaeilekvnkktalskeckdlaqevetalkkyavynhpkygkiyafevd gfgnhhlmddanvpsllampylgdvnvndpiyqntrrfvwsednpyffkgkagegiggph igydmvwpmsimmkaftsqndaeiktcikmlmdtdagtgfmhesfhkdnpkkftrawfaw qntlfgelilklvnegkvdllnsiq
Timeline for d3p2cb_: