![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.7: 14-3-3 protein [48445] (1 family) ![]() automatically mapped to Pfam PF00244 |
![]() | Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
![]() | Protein automated matches [190238] (11 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187008] (56 PDB entries) |
![]() | Domain d3p1qa1: 3p1q A:1-231 [183465] Other proteins in same PDB: d3p1qa2 automated match to d1qjba_ complexed with ca, cl, fsc, mg |
PDB Entry: 3p1q (more details), 1.7 Å
SCOPe Domain Sequences for d3p1qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p1qa1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]} merasliqkaklaeqaeryedmaafmkgavekgeelsneernllsvayknvvggqraawr vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkemppthpirlglalnfsvfh yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt
Timeline for d3p1qa1: