Lineage for d1jstb1 (1jst B:175-309)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4853Fold a.74: Cyclin-like [47953] (1 superfamily)
  4. 4854Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
  5. 4855Family a.74.1.1: Cyclin [47955] (3 proteins)
  6. 4856Protein Cyclin A [47956] (2 species)
  7. 4860Species Human (Homo sapiens) [TaxId:9606] [47957] (5 PDB entries)
  8. 4871Domain d1jstb1: 1jst B:175-309 [18346]
    Other proteins in same PDB: d1jsta_, d1jstc_

Details for d1jstb1

PDB Entry: 1jst (more details), 2.6 Å

PDB Description: phosphorylated cyclin-dependent kinase-2 bound to cyclin a

SCOP Domain Sequences for d1jstb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jstb1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens)}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

SCOP Domain Coordinates for d1jstb1:

Click to download the PDB-style file with coordinates for d1jstb1.
(The format of our PDB-style files is described here.)

Timeline for d1jstb1: