Lineage for d3p1me1 (3p1m E:65-184)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933781Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2933918Protein automated matches [190231] (14 species)
    not a true protein
  7. 2933945Species Human (Homo sapiens) [TaxId:9606] [189528] (5 PDB entries)
  8. 2933950Domain d3p1me1: 3p1m E:65-184 [183458]
    Other proteins in same PDB: d3p1ma2, d3p1mb2, d3p1mc2, d3p1md2, d3p1me2, d3p1mf2, d3p1mg2, d3p1mh2
    automated match to d1e6eb_
    complexed with fes, flc, gol, k

Details for d3p1me1

PDB Entry: 3p1m (more details), 2.54 Å

PDB Description: Crystal structure of human ferredoxin-1 (FDX1) in complex with iron-sulfur cluster
PDB Compounds: (E:) Adrenodoxin, mitochondrial

SCOPe Domain Sequences for d3p1me1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p1me1 d.15.4.1 (E:65-184) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkitvhfinrdgetlttkgkvgdslldvvvennldidgfgacegtlacstchlifedhiy
ekldaitdeendmldlaygltdrsrlgcqicltksmdnmtvrvpetvadarqsidvgkts

SCOPe Domain Coordinates for d3p1me1:

Click to download the PDB-style file with coordinates for d3p1me1.
(The format of our PDB-style files is described here.)

Timeline for d3p1me1: